EXOSC3 (Exosome Complex Exonuclease RRP40, Ribosomal RNA-processing Protein 40, Exosome Component 3, p10, RRP40, CGI-102, MGC15120, MGC723, RP11-3J10.8, Rrp40p, bA3J10.7, hRrp40p, p10) (Not for Export EU)

Size

£760.00

SKU:: 126509
Purity:: Serum
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Full length human EXOSC3, aa1-275 (NP_057126.2).
Format:: Supplied as a liquid.
Extra Details:: EXOSC3 is a component of the exosome 3'->5' exoribonuclease complex, a complex that degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions. It is required for the 3'processing of the 7S pre-RNA to the mature 5.8S rRNA. It has a 3'-5' exonuclease activity. Applications: Suitable for use in Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAEPASVAAESLAGSRARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVERPLSLNARACSRVRVVCGPGLRRCGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.