126490-ML550
EVI1 (MDS1 and EVI1 Complex Locus Protein EVI1, Ecotropic Virus Integration Site 1 Protein Homolog, EVI-1, MECOM) (MaxLight 550)
Size
£914.00
- SKU:
- 126490-ML550
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa952-1050 from human EVI1 (NP_005232) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 6A9
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
- Extra Details:
- MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000. EVI1 promotes cell proliferation by interacting with BRG1 and blocking the repression of BRG1 on E2F1 activity. EVI1 may be involved in megakaryocytic differentiation. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich FLISA: The detection limit is ~0.03ng/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: YKSGLSALDHIRHFTDSLKMRKMEDNQYSEAELSSFSTSHVPEELKQPLHRKSKSQAYAMMLSLSDKESLHSTSHSSSNVWHSMARAAAESSAIQSISH Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice