EVC (Ellis-van Creveld Syndrome Protein, DWF-1)

Size

£685.00

SKU:: 126489
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa493-602 from human EVC (NP_055371) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3C4
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Acts as a positive mediator of Hedgehog signaling indispensable for normal endochondral growth and skeletal development. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit is 0.3ng/ml as a capture antibody Optimal dilutions to be determined by the researcher. Amino Acid Sequence: VLERQRLMQCDLEEEENVRATEAVVALCQELYFSTVDTFQKFVDALFLQTLPGMTGLPPEECDYLRQEVQENAAWQLGKSNRFRRQQWKLFQELLEQDQQVWMEECALSS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.