126479-BIOTIN

ETS1 (Protein C-ets-1, p54, EWSR2) (Biotin)

Size

£914.00

SKU:: 126479-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa173-272 from human ETS1 (AAH17314.1) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2G10
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: ETS1, a 441aa protein, is a member of DNA-binding ETS protein family. It is a multifunctional protein consisting of an N-terminal pointed domain, a central transactivation domain and 2 auto inhibitory domains flanked on both sides of conserved C-terminal Ets domain. It interacts with factors including PEBP2alphaA, p300/CBP and mediates transactivation of Osteopontin, Presenilin-1, Stromelysin and Collagenase. It is activated by Ras/MAPK signaling and its expression is up-regulated in resting T-cells. Its activity is modulated by various factors including AP-1, Sp-1, c-myb and MafB. Sp100 activates ETS1 in nuclear bodies. It interacts with EAP1/Daxx and causes repression of MMP1 and BCL2 transactivation. It interacts with STAT6 and modulates Socs-1 expression induced by IL-4. It interacts with GATA3 and positively regulates Tax-1 dependent IL-5 expression. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit is 1ng/ml as a capture antibody Optimal dilutions to be determined by the researcher. Amino Acid Sequence: SEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCGQEMGKEEKQT Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice