ETF1 (Eukaryotic Peptide Chain Release Factor Subunit 1, Eukaryotic Release Factor 1, eRF1, TB3-1, Protein Cl1, SUP45L1, RF1, ERF1)

Size

£685.00

SKU:: 126472
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa338-437 from human ETF1 (NP_004721.1) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2H4
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: ETF1 directs the termination of nascent peptide synthesis (translation) in response to the termination codons UAA, UAG and UGA. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TEEEKILYLTPEQEKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGDDEFFDLDDY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.