126458
ESD (S-formylglutathione Hydrolase, FGH, Esterase D)
Size
£685.00
- SKU:
- 126458
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa183-281 from human ESD (NP_001975.1) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1E1
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Extra Details:
- ESD belongs to the esterase D family. This protein is active toward numerous substrates including O-acetylated sialic acids, and it may be involved in the recycling of sialic acids. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: WGKKAFSGYLGTDQSKWKAYDATHLVKSYPGSQLDILIDQGKDDQFLLDGQLLPDNFIAACTEKKIPVVFRLQEGYDHSYYFIATFITDHIRHHAKYLN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice