ESCO1 (N-acetyltransferase ESCO1, CTF7 Homolog 1, Establishment Factor-like Protein 1, EFO1p, hEFO1, Establishment of Cohesion 1 Homolog 1, ECO1 Homolog 1, ESO1 Homolog 1, EFO1, KIAA1911, MGC105022)

Size

£685.00

SKU:: 126454
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length human ESCO1, aa1-172 (AAH36943.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Establishment of cohesion 1 homolog 1 (Eco1) is an acetyltransferase that is required for the establishment of sister chromatid cohesion during DNA replication, but not for its maintenance during G2 and M phases. It is also required for postreplicative double-strand break repair. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Seqeunce: MVLPEDPKYALKKVDEIREMVDNDLGFQQAPLMCYSRTKTLLFISNDKKVVGCLIAEHIQWGYRVIEEKLPVIRSEEEKVRFERQKAWCCSTLPEPAICGISRIWVFSMMRRKKIASRMIECLRSNFIYGSYLSKEEIAFSDPTPDGKLFATQYCGTGQFLVYNFINGQNST Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.