ERH (Enhancer Of Rudimentary Homolog, DROER, FLJ27340)

Size

£685.00

SKU:: 126440
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-104 from human ERH (AAH14301) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4A10
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: ERH, also known as enhancer of rudimentary homolog, is a ubiquitously expressed transcriptional coregulator that is highly conserved among eukaryotes. It may play a role in cell cycle regulation and pyrimidine biosynthesis. It has two casein kinase II phosphorylation sites that are thought to disrupt the ability of ERH to dimerize. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.