126419-ML490
ErbB2 (Receptor Tyrosine-protein Kinase erbB-2, Metastatic Lymph Node Gene 19 Protein, MLN 19, Proto-oncogene Neu, Proto-oncogene c-ErbB-2, Tyrosine Kinase-type Cell Surface Receptor HER2, CD340, p185erbB2, HER2, MLN19, NEU, NGL) (MaxLight 490)
Size
£914.00
- SKU:
- 126419-ML490
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa22-121 from human ErbB2 with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3B1
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Extra Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. The ErbB-2 (HER-2/neu) proto-oncogene encodes a 185kD transmembrane receptor protein. It has partial homology with the epidermal growth factor (EGF) receptor and shares intrinsic tyrosine kinase activity with the receptor. ErbB-2 heterodimerizes with the EGF receptor, ErbB-3 receptor, and the ErbB-4 receptor. In human breast and ovarian cancers the receptor is activated through amplification and over-expression of the wild-type gene. This alteration occurs in 25%-30% of cases and is associated with a poor prognosis. The poor prognosis of ovarian and breast cancer patients associated with ErbB-2-mediated high rate of tumor cell proliferation. ErbB-2 may play a role in the genesis of human gastric, endometrial and salivary gland cancers. The concentration of ErbB-2 protein in serum can be a sensitive indicator for prognosis of the gastric carcinoma that expressed ErbB-2. ErbB-2 oncoprotein is detectable in adenocarcinomas as well as in transitional cell carcinomas. Applications: Suitable for use in Immunofluorescence, FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry: Formalin-fixed, paraffin-embedded sections Optimal dilutions to be determined by the researcher. AA Sequence: STQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGD Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice