126419-HRP

ErbB2 (Receptor Tyrosine-protein Kinase erbB-2, Metastatic Lymph Node Gene 19 Protein, MLN 19, Proto-oncogene Neu, Proto-oncogene c-ErbB-2, Tyrosine Kinase-type Cell Surface Receptor HER2, CD340, p185erbB2, HER2, MLN19, NEU, NGL) (HRP)

Size

£914.00

SKU:: 126419-HRP
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa22-121 from human ErbB2 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3B1
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Extra Details:: The ErbB-2 (HER-2/neu) proto-oncogene encodes a 185kD transmembrane receptor protein. It has partial homology with the epidermal growth factor (EGF) receptor and shares intrinsic tyrosine kinase activity with the receptor. ErbB-2 heterodimerizes with the EGF receptor, ErbB-3 receptor, and the ErbB-4 receptor. In human breast and ovarian cancers the receptor is activated through amplification and over-expression of the wild-type gene. This alteration occurs in 25%-30% of cases and is associated with a poor prognosis. The poor prognosis of ovarian and breast cancer patients associated with ErbB-2-mediated high rate of tumor cell proliferation. ErbB-2 may play a role in the genesis of human gastric, endometrial and salivary gland cancers. The concentration of ErbB-2 protein in serum can be a sensitive indicator for prognosis of the gastric carcinoma that expressed ErbB-2. ErbB-2 oncoprotein is detectable in adenocarcinomas as well as in transitional cell carcinomas. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry: Formalin-fixed, paraffin-embedded sections Optimal dilutions to be determined by the researcher. AA Sequence: STQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGD Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice