126419-BIOTIN

ErbB2 (Receptor Tyrosine-protein Kinase erbB-2, Metastatic Lymph Node Gene 19 Protein, MLN 19, Proto-oncogene Neu, Proto-oncogene c-ErbB-2, Tyrosine Kinase-type Cell Surface Receptor HER2, CD340, p185erbB2, HER2, MLN19, NEU, NGL) (Biotin)

Size

£914.00

SKU:: 126419-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa22-121 from human ErbB2 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3B1
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: The ErbB-2 (HER-2/neu) proto-oncogene encodes a 185kD transmembrane receptor protein. It has partial homology with the epidermal growth factor (EGF) receptor and shares intrinsic tyrosine kinase activity with the receptor. ErbB-2 heterodimerizes with the EGF receptor, ErbB-3 receptor, and the ErbB-4 receptor. In human breast and ovarian cancers the receptor is activated through amplification and over-expression of the wild-type gene. This alteration occurs in 25%-30% of cases and is associated with a poor prognosis. The poor prognosis of ovarian and breast cancer patients associated with ErbB-2-mediated high rate of tumor cell proliferation. ErbB-2 may play a role in the genesis of human gastric, endometrial and salivary gland cancers. The concentration of ErbB-2 protein in serum can be a sensitive indicator for prognosis of the gastric carcinoma that expressed ErbB-2. ErbB-2 oncoprotein is detectable in adenocarcinomas as well as in transitional cell carcinomas. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry: Formalin-fixed, paraffin-embedded sections Optimal dilutions to be determined by the researcher. AA Sequence: STQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGD Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice