126412-BIOTIN

EPS8L2 (Epidermal Growth Factor Receptor Kinase Substrate 8-like Protein 2, EPS8-like Protein 2, EPS8-related Protein 2, EPS8R2, FLJ16738, FLJ21935, FLJ22171, MGC3088, MGC126530) (Biotin)

Size

£914.00

SKU:: 126412-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa615-714 from human EPS8L2 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 6C2
Format:: Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with Biotin.
Extra Details:: Stimulates guanine exchange activity of SOS1. May play a role in membrane ruffling and remodeling of the actin cytoskeleton. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: ERSQPVSQPLTYESGPDEVRAWLEAKAFSPRIVENLGILTGPQLFSLNKEELKKVCGEEGVRVYSQLTMQKAFLEKQQSGSELEELMNKFHSMNQRRGED Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.