EPOR (Erythropoietin Receptor, MGC138358)

Size

£685.00

SKU:: 126407
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa31-130 from human EPOR (NP_000112) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3D10
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Epo R is a transmembrane protein expressed on the surface of megakaryocytes, erythroid progenitors, and endothelial cells. It binds Epo and transmits signals that stimulate the proliferation and maturation of bone marrow erythroid precursors into red cells. Applications: Suitable for use in ELISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.