EPHB6 (Ephrin Type-A Receptor 6, Tyrosine-protein Kinase Receptor EPH-6, HEP)

Size

£685.00

SKU:: 126392
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa23-122 from EPHB6 (NP_004436) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5D8
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: EPHB6 belongs to the ephrin receptor kinase family. EPHB6 does not have intrinsic tyrosine kinase activity because six invariant amino acids were have been substituted. Despite its lack of kinase activity, ligand binding results in trans-phosphorylation of EphB6 and the initiation of specific cytoplasmic signaling events. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: DTTGETSEIGWLTYPPGGWDEVSVLDDQRRLTRTFEACHVAGAPPGTGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVSGGTCRETFTLYYRQAEE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.