126392-PE
EPHB6 (Ephrin Type-A Receptor 6, Tyrosine-protein Kinase Receptor EPH-6, HEP) (PE)
Size
£914.00
- SKU:
- 126392-PE
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa23-122 from EPHB6 (NP_004436) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 5D8
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
- Extra Details:
- EPHB6 belongs to the ephrin receptor kinase family. EPHB6 does not have intrinsic tyrosine kinase activity because six invariant amino acids were have been substituted. Despite its lack of kinase activity, ligand binding results in trans-phosphorylation of EphB6 and the initiation of specific cytoplasmic signaling events. Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: DTTGETSEIGWLTYPPGGWDEVSVLDDQRRLTRTFEACHVAGAPPGTGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVSGGTCRETFTLYYRQAEE Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice