EphB3 (Ephrin Type-B receptor 3, Tyrosine-protein Kinase Receptor HEK-2, EPH-like Kinase 2, EK2, Tyrosine-protein Kinase TYRO6, ETK2, HEK2, TYRO6)

Size

£685.00

SKU:: 126390
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa899-997 from human EPHB3 (NP_004434) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1B3
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. EphB3, a member of the Tyr family of protein kinases, is a receptor for members of the ephrin-B family; it binds to both ephrin-B1 and -B2. Expression of this Type I membrane protein is ubiquitous. The protein contains putative domains for 2 fibronectin type III and 1 sterile alpha motif (SAM). Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: AASLKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQMTAEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice