EPHA2 (Ephrin Type-A Receptor 2, Epithelial Cell Kinase, Tyrosine-protein Kinase Receptor ECK, ECK)

Size

£685.00

SKU:: 126380
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa204-326 from human EPHA2 (AAH37166) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1E3
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: EphA2 is a 976aa oncoprotein belonging to the ephrin receptor subfamily of the protein-tyrosine kinase family. It consists of an external domain that includes a signal peptide, a transmembrane domain and a cytoplasmic domain that contains a canonical protein-tyrosine kinase catalytic domain. EphA2 are the largest receptor tyrosine kinase that binds ephrin-A ligands and play an important role in axon guidance and cell migration during development of the nervous system. Over expression of EphA2 is regulated by p53 and is known to be involved in tumor metastasis and angiogenesis. It is highly expressed in tissues that contain a high proportion of epithelial cells, including lung, skin, small intestine, and ovary and also in metastatic melanoma cells. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: LLQGLAHFPETIAGSDAPSLATVAGTCVDHAVVPPGGEEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGFFKFEASESPCLECPEHTLPSPEGATSCECEEGFFRAPQDPASMPCT Storage and Stability: May be stored at 4°C. For long-term storage, aliquot and store at 4°C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer.

Shipping Conditions:: Blue Ice