126380-ML650
EPHA2 (Ephrin Type-A Receptor 2, Epithelial Cell Kinase, Tyrosine-protein Kinase Receptor ECK, ECK) (MaxLight 650)
Size
£914.00
- SKU:
- 126380-ML650
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa204-326 from human EPHA2 (AAH37166) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1E3
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Extra Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. EphA2 is a 976aa oncoprotein belonging to the ephrin receptor subfamily of the protein-tyrosine kinase family. It consists of an external domain that includes a signal peptide, a transmembrane domain and a cytoplasmic domain that contains a canonical protein-tyrosine kinase catalytic domain. EphA2 are the largest receptor tyrosine kinase that binds ephrin-A ligands and play an important role in axon guidance and cell migration during development of the nervous system. Over expression of EphA2 is regulated by p53 and is known to be involved in tumor metastasis and angiogenesis. It is highly expressed in tissues that contain a high proportion of epithelial cells, including lung, skin, small intestine, and ovary and also in metastatic melanoma cells. Applications: Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: LLQGLAHFPETIAGSDAPSLATVAGTCVDHAVVPPGGEEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGFFKFEASESPCLECPEHTLPSPEGATSCECEEGFFRAPQDPASMPCT Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice