126347-FITC

ENTH (Clathrin Interactor 1, Epsin-4, Epsin-related Protein, EpsinR, Enthoprotin, Clathrin-interacting Protein Localized in the Trans-Golgi region, Clint, KIAA0171, EPNR, EPN4, CLINT1) (FITC)

Size

£914.00

SKU:: 126347-FITC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa161-261 from ENTH (NP_055481) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1E6
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Extra Details:: One of the main pathways by which membrane components and proteins are taken into a cell is through clathrin-mediated endocytosis. This pathway leads to the building and formation of clathrin-coated pits, also known as CCVs. Enthoprotin is a highly enriched protein localized on the CCVs, interacting with AP1 and Arf-binding protein 2, both clathrin adaptors. Through the binding of the clathrin heavy chain by its COOH-terminal domain, Enthoprotin induces clathrin production. Abnormalities in the gene encoding for Enthoprotin affect genetic susceptibility to Schizophrenia type I, a highly heritable psychosis. Enthoprotin is expressed throughout tissue types at intermediate to low levels. Applications: Suitable for use in FLISA, Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: GVSSDSVGGFRYSERYDPEPKSKWDEEWDKNKSAFPFSDKLGELSDKIGSTIDDTISKFRRKDREDSPERCSDSDEEKKARRGRSPKGEFKDEEETVTTKH Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice