126332-APC
ENO2 (Gamma-enolase, 2-phospho-D-glycerate hydro-lyase, Enolase 2, Neural Enolase, Neuron-specific Enolase, NSE) (APC)
Size
£927.00
- SKU:
- 126332-APC
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa325-434 from human ENO2 (AAH02745) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1A3
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Extra Details:
- Enolase is a glycolytic enzyme catalyzing the reaction pathway between 2 phospho glycerate and phosphoenol pyruvate. In mammals, enolase molecules are dimers composed of three distinct subunits (alpha, beta and gamma). The alpha subunit is expressed in most tissues and the beta subunit only in muscle. The gamma subunit is expressed primarily in neurons, in normal and in neoplastic neuroendocrine cells. NSE (neuron specific enolase) is found in elevated concentrations in plasma and certain neoplasias. These include pediatric neuroblastoma and small cell lung cancer. Coexpression of NSE and chromogranin A is common in neuroendocrine neoplasms. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PKRIERAVEEKACNCLLLKVNQIGSVTEAIQACKLAQENGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDEARFAGHNFRNPSVL Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice