EMP3 (Epithelial Membrane Protein 3, YMP, EMP-3, Hematopoietic Neural Membrane Protein 1, HNMP-1, Protein YMP)

Size

£685.00

SKU:: 126309
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-163 from human EMP3 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3D4
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Epithelial membrane protein 3 (EMP3) is a multipass transmembrane protein in the peripheral myelin protein 22 family. It is expressed as a 20-25kD molecule depending on the degree of glycosylation. EMP3 interacts with the P2X7 purinergic receptor on monocytes. Its dysregulation is associated with glioma and neuroblastoma. Human EMP3 shares 93% aa sequence identity with mouse and rat EMP3. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilutions: Immunohistochemistry (FFPE): 3ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQVLMVLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAIHAEEILEKHPRGGSFGYCFALAWVAFPLALVSGIIYIHLRKRE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.