126307-FITC

EML4 (Echinoderm Microtubule-associated Protein-like 4, EMAP-4, Restrictedly Overexpressed Proliferation-associated Protein, Ropp 120, C2orf2, EMAPL4) (FITC)

Size

£914.00

SKU:: 126307-FITC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-63 from human EML4 (AAH08685) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3C10
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Extra Details:: May modify the assembly dynamics of microtubules, such that microtubules are slightly longer, but more dynamic. Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MCYTPCKKYTDMNRQFLEKKEHFFKYLGNTALSDQQGVYLRTSVTFGVAMYNEIYNHDTLRW* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.