126282-FITC
ELK1 (ETS Domain-containing Protein Elk-1) (FITC)
Size
£914.00
- SKU:
- 126282-FITC
- Application:
- FLISA
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa67-166 from human ELK1 (NP_005220) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2G6
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Extra Details:
- Elk-1 is a transcription factor that binds the serum response element (SRE) and mediates gene activity in response to serum and growth factors. Elk-1 is phosphorylated by MAP kinase pathways and appears to be a direct target of activated MAP kinase. Biochemical studies indicate that Elk-1 is a good substrate for MAP kinase. The kinetics of Elk-1 phosphorylation and activation correlate with MAP kinase activity. Other studies have shown that Elk-1 (Ser383) is also a target of the stress-activated kinase SAPK/JNK. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: YYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIHAAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQS Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice