126282-BIOTIN
ELK1 (ETS Domain-containing Protein Elk-1) (Biotin)
Size
£914.00
- SKU:
- 126282-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa67-166 from human ELK1 (NP_005220) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2G6
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- Elk-1 is a transcription factor that binds the serum response element (SRE) and mediates gene activity in response to serum and growth factors. Elk-1 is phosphorylated by MAP kinase pathways and appears to be a direct target of activated MAP kinase. Biochemical studies indicate that Elk-1 is a good substrate for MAP kinase. The kinetics of Elk-1 phosphorylation and activation correlate with MAP kinase activity. Other studies have shown that Elk-1 (Ser383) is also a target of the stress-activated kinase SAPK/JNK. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: YYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIHAAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQS Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice