126278-ML650
ELF3 (E74-like Factor 3 (ets Domain Transcription Factor, Epithelial-specific), EPR-1, ERT, Epithelium-specific Ets Transcription Factor 1, ESE-1, Epithelial-restricted with Serine Box, ESX) (MaxLight 650)
Size
£914.00
- SKU:
- 126278-ML650
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa262-371 from human ELF3 (AAH03569) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1D8
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Extra Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. ELF3 is a 41-43kD member of the ETS family of proteins. During uncomplicated (non-inflammatory) periods of cell differentiation, ELF3 is expressed exclusively by epithelial cells, repressing genes needed during early differentiation, and promoting genes needed for full differentiation. Under conditions of inflammation, cells such as monocytes, endothelial cells and chrondrocytes express ELF3 and produce molecules such as Ang1 and COX2. Human ELF3 is 371aa in length. It contains one PNT/pointed dimerization domain aa46-132, a protein stabilizing PEST sequence aa210-225, an A/T Hook region that binds to AT-rich DNA sequences aa236-252, and an ETS DNA binding domain aa273-355. ELF3 interacts with CREBBP, EP300, KU70 and KU86. There is one splice variant that shows a deletion of aa174-200. Over aa1-173, human ELF3 shares 87aa identity with mouse ELF3. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EGKKSKHAPRGTHLWEFIRDILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNSSGWKEEEVLQSRN Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice