EIF5B (Eukaryotic Translation Initiation Factor 5B, eIF-5B, Translation Initiation Factor IF-2, IF2, KIAA0741, DKFZp434I036, eIF-5B, FLJ10524)

Size

£685.00

SKU:: 126258
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1121-1218 from EIF5B (NP_056988) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3F9
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Function in general translation initiation by promoting the binding of the formylmethionine-tRNA to ribosomes. Seems to function along with eIF-2. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QGTPMCVPSKNFVDIGIVTSIEINHKQVDVAKKGQEVCVKIEPIPGESPKMFGRHFEATDILVSKISRQSIDALKDWFRDEMQKSDWQLIVELKKVFE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.