EIF4G1 (Eukaryotic Translation Initiation Factor 4 gamma 1, eIF-4-gamma 1, eIF-4G 1, eIF-4G1, p220, EIF4G1, EIF4F, EIF4G, EIF4GI)

Size

£685.00

SKU:: 126246
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1500-1599 from human EIF4G1 (NP_886553) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2A9
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: EIF4G1 is a component of the protein complex EIF4F, which is involved in the recognition of the mRNA cap, ATP-dependent unwinding of 5'-terminal secondary structure, and recruitment of mRNA to the ribosome. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: DVAVLKARAKLLQKYLCDEQKELQALYALQALVVTLEQPPNLLRMFFDALYDEDVVKEDAFYSWESSKDPAEQQGKGVALKSVTAFFKWLREAEEESDHN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.