EIF4EBP2 (Eukaryotic Translation Initiation Factor 4E-binding Protein 2, 4E-BP2, eIF4E-binding Protein 2)

Size

£685.00

SKU:: 126241
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa61-120 from human EIF4EBP2 (NP_004087) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2G8
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: This protein regulates eIF4E activity by preventing its assembly into the eIF4F complex. Mediates the regulation of protein translation by hormones, growth factors and other stimuli that signal through the MAP kinase pathway. Nonphosphorylated EIF4EBP2 interacts with EIF4E. Phosphorylated on serine and threonine residues in response to insulin, EGF and PDGF. Belongs to the eIF4E binding protein family. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.