EID1 (EP300-interacting Inhibitor of Differentiation 1, 21kD pRb-associated Protein, CREBBP/EP300 Inhibitory Protein 1, E1A-like Inhibitor of Differentiation 1, EID-1, C15orf3, CRI1, RBP21, PNAS-22, PTD014)

Size

£685.00

SKU:: 126217
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length human CRI1, aa1-187 (NP_055150.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: EID1 ia an acetyltransferase enzyme. It acetylates histones, giving a specific tag for transcriptional activation. EID1 also acetylates no- histone proteins, like NCOA3 coactivator. It Mediates cAMP gene regulation by binding specifically to phosphorylated CREB protein and as coactivator, augments the activity of phosphorylated CREB to activate transcription of cAMP responsive genes. Applications: Suitable for use in Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MSEMAELSELYEESSDLQMDVMPGEGDLPQMEVGSGSRELSLRPSRSGAQQLEEEGPMEEEEAQPMAAPEGKRSLANGPNAGEQPGQVAGADFESEDEGEEFDDWEDDYDYPEEEQLSGAGYRVSAALEEADKMFLRTREPALDGGFQMHYEKTPFDQLAFIEELFSLMVVNRLTEELGCDEIIDRE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.