126216-FITC

EHMT1 (Histone H3-K9 Methyltransferase 5, H3-K9-HMTase 5, Euchromatic Histone-lysine N-methyltransferase 1, Eu-HMTase1, G9a-like Protein 1, GLP1, Lysine N-methyltransferase 1D, EHMT1, EUHMTASE1, KIAA1876, KMT1D, bA188C12.1, DEL9q34, DKFZp667M072, FLJ12879, FP13812) (FITC)

Size

£914.00

SKU:: 126216-FITC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-101 from human EHMT1 (NP_079033) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3G1
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Extra Details:: EHMT1, also known as EUHMTASE1, is a histone methyltransferase. This protein methylates 'Lys-9' of histone H3 in vitro. H3 'Lys-9' methylation represents a specific tag for epigenetic transcriptional repression by recruiting HP1 proteins to methylated histones. EHMT1 is Probably targeted to histone H3 by different DNA-binding proteins like E2F6, MGA, MAX and/or DP1. During G0 phase, it probably contributes to silencing of MYC- and E2F-responsive genes, suggesting a role in the G0/G1 transition of the cell cycle. Applications: Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MAADEGSAEKQAGEAHMAADGETNGSCENSDASSHANAAKHTQDSARVNPQDGTNTLTRIAENGVSERDSEAAKQNHVTADDFVQTSVIGSNGYILNKPA Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice