126208-ML490
EGR2 (Early Growth Response Protein 2, EGR-2, AT591, Zinc Finger Protein Krox-20, KROX20, DKFZp686J1957, FLJ14547) (MaxLight 490)
Size
£914.00
- SKU:
- 126208-ML490
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa217-293 from human EGR2 (NP_000390.2) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1G5
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Extra Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. The EGR2 gene provides instructions for making a protein called early growth response 2, which is part of the early growth response family of proteins. These proteins bind to specific areas of DNA and help control the activity of particular genes. On the basis of this action, the proteins are referred to as transcription factors. The early growth response 2 protein activates several genes that are involved in the formation and maintenance of myelin, the fatty substance that covers and protects nerve cells. Myelin promotes the efficient transmission of nerve impulses. If myelin is lost (demyelination) or its structure is disrupted, the transmission of nerve impulses is impaired. Mutations in the EGR2 gene can cause two forms of Charcot-Marie-Tooth disease, type 1D or type 4E (sometimes called congenital hypomyelinating neuropathy) or a severe form of type 1D (sometimes called Dejerine-Sottas syndrome) that begins during infancy or early childhood. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PGLFPMIPDYPGFFPSQCQRDLHGTAGPDRKPFPCPLDTLRVPPPLTPLSTIRNFTLGGPSAGVTGPGASGGSEGPR Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice