EGR1 (Early Growth Response Protein 1, EGR-1, Zinc Finger Protein Krox-24, Transcription Factor Zif268, Nerve Growth Factor-induced Protein A, NGFI-A, Transcription Factor ETR103, Zinc Finger Protein 225, AT225, ZNF225, KROX24)

Size

£685.00

SKU:: 126206
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa444-543 from human EGR1 (NP_001955) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 6E8
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: EGR1 belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.