EDG3 (Sphingosine 1-phosphate Receptor 3, S1P Receptor 3, S1P3, Endothelial Differentiation G-protein Coupled Receptor 3, Sphingosine 1-phosphate Receptor Edg-3, S1P Receptor Edg-3, S1PR3)

Size

£685.00

SKU:: 126158
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa302-378 from human EDG3 (NP_005217.2) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2G11
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: EDG3 is a member of the EDG family of receptors, which are G protein-coupled receptors. This protein has been identified as a functional receptor for sphingosine 1-phosphate and likely contributes to the regulation of angiogenesis and vascular endothelial cell function. Applications: Suitable for use in ELISA and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: SKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAPSSCIMDKNAALQNGIFCN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.