126156
EDG1 (Sphingosine 1-phosphate Receptor 1, S1P Receptor 1, S1P1, Endothelial Differentiation G-protein Coupled Receptor 1, Sphingosine 1-phosphate Receptor Edg-1, S1P Receptor Edg-1, CD363, CHEDG1)
Size
£760.00
- SKU:
- 126156
- Application:
- WB
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length human EDG1, aa1-382 (NP_001391.2).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Extra Details:
- Edg-1 is a heterotrimeric orphan receptor for lysosphingolipid sphingosine 1-phosphate (S1P) and belongs to the G-protein coupled receptor 1 family with seven putative transmembrane domains. Human Edg-1 is a highly inducible and abundant endothelial cell GPR that helps in the regulation of differentiation of endothelial cells. S1P-induced endothelial cell migration requires the PKB:AKT1 mediated phosphorylation of Edg-1. Activation of Edg-1 induces cell-cell adhesion and it also helps in modulating intracellular Ca2+ homeostasis. It is rapidly induced when endothelial cells are treated with the tumor promoter phorbol 12-myristate 13-acetate (PMA) and super induced in the presence of cycloheximide. Over expression of Edg-1 leads to cell-cell aggregation, enhanced expression of cadherins and formation of well-developed adherens junctions. Edg-1 is widely expressed in many tissues with low expression in vascular smooth muscle cells, fibroblasts, melanocytes, and cells of epithelioid origin. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSSGNVNSSS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice