E2IG3 (Nucleostemin, GNL3, Guanine Nucleotide-binding Protein-Like 3, Nucleolar GTP-binding Protein 3, Nucleostemin, E2-induced Gene 3 Protein, Novel Nucleolar Protein 47, NNP47, NS)

Size

£685.00

SKU:: 126122
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa328-427 from human GNL3 (AAH01024) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1A1
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: GNL3 may be required to maintain the proliferative capacity of stem cells. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: IEVVKPMEAASAILSQADARQVVLKYTVPGYRNSLEFFTMLAQRRGMHQKGGIPNVEGAAKLLWSEWTGASLAYYCHPPTSWTPPPYFNESIVVDMKSGF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.