126122-APC

E2IG3 (Nucleostemin, GNL3, Guanine Nucleotide-binding Protein-Like 3, Nucleolar GTP-binding Protein 3, Nucleostemin, E2-induced Gene 3 Protein, Novel Nucleolar Protein 47, NNP47, NS) (APC)

Size

£927.00

SKU:: 126122-APC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa328-427 from human GNL3 (AAH01024) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1A1
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Extra Details:: GNL3 may be required to maintain the proliferative capacity of stem cells. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: IEVVKPMEAASAILSQADARQVVLKYTVPGYRNSLEFFTMLAQRRGMHQKGGIPNVEGAAKLLWSEWTGASLAYYCHPPTSWTPPPYFNESIVVDMKSGF Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.