126111-BIOTIN
E2F1 (Transcription Factor E2F1, E2F-1, PBR3, PRB-binding Protein E2F-1, RBBP-3, Retinoblastoma-associated Protein 1, RBAP-1, Retinoblastoma-binding Protein 3, RBBP3) (Biotin)
Size
£914.00
- SKU:
- 126111-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa348-437 from human E2F1 (NP_005216.1) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2E10
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- The E2F family of transcription factors appears to play a critical role in the transcription of certain genes required for cell cycle progression. E2F1, the first cloned member of this family, is regulated during the cell cycle at the mRNA level by changes in transcription of the E2F1 gene and at the protein level by complex formation with proteins such as the retinoblastoma gene product (pRB), cyclin A and DP1. It binds to variants of the consensus sequence TTTCGCGC, found in the promoters of a number of genes important for cell cycle progression, including c-myc, cdc2, cdc6, dihydrofolate reductase, thymidine kinase, and the E2F-1 gene itself. It plays an important role in both cell cycle regulation and apoptosis. It promotes entry into S phase and stimulates cell cycle progression. It function is regulated by the retinoblastoma protein, which binds to the transactivation domain of E2F-1 and suppresses E2F-1-mediated transcriptional activation. It exhibits dual function, can stimulate cell cycle progression as an oncogene, or can promote p53-dependent apoptosis and suppress tumorigenesis as a tumor suppressor gene. Fluorescence in situ hybridization localized E2F1 to chromosome 20q11. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QSLLSLEQEPLLSRMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEGIRDLFDCDFGDLTPLDF Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice