DVL3 (Dishevelled-3, Dsh Homolog 3, Segment Polarity Protein Dishevelled Homolog DVL-3, KIAA0208)

Size

£685.00

SKU:: 126085
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-100 from human DVL3 (AAH32459) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4H2
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Dishevelled-3 (DVL-3) is a cytoplasmic phoshoprotein that regulates cell proliferation, acting as a transducer molecule for developmental processes including segmentation and neuroblast specification in Drosophila. It is known to play a crucial role in WNT canonical signaling pathway and has been shown to be a connecting link between the Notch-WNT crosstalk. The structural and evolutionary characteristics suggest that mutations at their loci may be involved in neural and heart development defects. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEISDDNAKLPCFNGRVVSWLVSAEGSHPDPAPFCADNPSELP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.