DUSP23 (Dual Specificity Phosphatase 23, DUSP25, FLJ20442, Low Molecular Mass Dual Specificity Phosphatase 3, LDP3, LDP-3, MOSP, RP11-190A12.1, VH1-like Phosphatase Z, VHZ)

Size

£760.00

SKU:: 126066
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Full length human DUSP23, aa1-150 (NP_060293.2).
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Most of dual-specificity protein phosphatases (DSPs) play an important role in the regulation of mitogenic signal transduction and controlling the cell cycle in response to extracellular stimuli . DUSP23 has been shown to dephosphorylate p44ERK1 but not p38 and p54SAPKbeta in vitro. Reverse transcription-PCR (RT-PCR) revealed that the DUSP23 was expressed in most fetal tissues and two adult tissues: testis and colon. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHRLRIPDFCPPAPDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEKAVFQFYQRTK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.