126065-BIOTIN

DUSP22 (Dual Specificity Protein Phosphatase 22, JKAP, JNK-stimulatory Phosphatase-1, JSP1, JSP-1, Low Molecular Weight Dual Specificity Phosphatase 2, LMWDSP2, LMW-DSP2, Mitogen-activated Protein Kinase Phosphatase x, MAP Kinase Phosphatase x, MKPX, MKP-x, VHX) (Biotin)

Size

£914.00

SKU:: 126065-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa112-185 from human DUSP22 (NP_064570) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3D3
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: DUSP22 is member of the dual-specificity phosphatase (DSP) family, which catalyzes dephosphorylation of phosphotyrosine and phosphothreonine residues. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.