126057-ML490
DUSP14 (Dual Specificity Protein Phosphatase 14, Mitogen-activated Protein Kinase Phosphatase 6, MAP Kinase Phosphatase 6, MKP6, MKP-6, MKP-1-like Protein Tyrosine Phosphatase, MKP-L) (MaxLight 490)
Size
£914.00
- SKU:
- 126057-ML490
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-199 from human DUSP14 (AAH00370) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 4B5-E6
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Extra Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. DUSP14 is involved in the inactivation of MAP kinases. This proein dephosphorylates ERK, JNK and p38 MAP-kinases. In addition to antigen recognition by the T-cell receptor, T-cell activation requires a second signal from a costimulatory receptor, such as CD28, which interacts with B7-1 (CD80) and B7-2 (CD86) ligands on antigen-presenting cells. CD28 costimulation induces transcription of interleukin-2 and stabilizes newly synthesized IL2 through the activation of mitogen-activated protein kinases (MAPKs), such as ERK and JNK, and the subsequent creation of AP1 transcription factor. DUSP14 is a negative regulator of CD28 signaling. Applications: Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGI Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice