DTYMK (Thymidylate Kinase, dTMP Kinase, CDC8, TMPK, TYMK)

Size

£698.00

SKU:: 126046
Purity:: Ascites
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa103-212 from human DTYMK (NP_036277) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2C2
Format:: Supplied as a liquid in ascites fluid.
Extra Details:: Thymidylate kinase (DTYMK) catalyzes the phosphorylation of dTMP to form dTDP in the dTTP synthesis pathway for DNA synthesis. DTYMK is essential for DNA synthesis and is an important intermediate enzyme in the pathway of many pyrimidine analog drugs, including 5-Fluorouracil (5-FU), the chemotherapeutic drug of choice for several solid tumors. The human DTYMK gene was isolated via functional complementation of a Saccharomyces cerevisiae cell cycle mutant, cdc8. DTYMK mRNA levels and enzyme activities are regulated at the level of cell cycle and cell growth pathways. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIRTATEKPLGELWK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.