126043-BIOTIN

DTX3 (RNF154, Probable E3 Ubiquitin-protein Ligase DTX3, Protein Deltex-3, RING Finger Protein 154, FLJ34766, MGC138863, MGC138864) (Biotin)

Size

£914.00

SKU:: 126043-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa201-301 from human DTX3 (NP_848597) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4F10
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: DTX3 functions as an E3 ubiquitin ligase (Takeyama et al., 2003 [PubMed 12670957]). Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MCGRFYGQLVGNQPQNGRMLVSKDATLLLPSYEKYGTIVIQYVFPPGVQGAEHPNPGVRYPGTTRVAYLPDCPEGNKVLTLFRKAFDQRLTFTIGTSMTT Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.