DRF1 (ASKL1, Protein DBF4 Homolog B, Activator of S Phase Kinase-like Protein 1, Chiffon Homolog B, Dbf4-related Factor 1, FLJ13087, MGC15009)

Size

£685.00

SKU:: 126023
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa201-300 from human DBF4B (NP_663696) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1A7
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: DBF4B encodes a regulator of the CDC7-like 1 protein, a serine-threonine kinase which links cell cycle regulation to genome duplication. This protein localizes to the nucleus and its expression is cell cycle-regulated. Alternative splicing of this gene results in two transcript variants encoding different isoforms. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VKKQQPKKPEGTCPAAESRTRKVARLKAPFLKIEDESRKFRPFHHQFKSFPEISFLGPKDASPFEAPTTLGSMHHTRESKDGEPSPRSAAHTMPRRKKG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.