126013-ML550

DR4 (Death Receptor 4, Apo2, CD261, CD261 Antigen, Cytotoxic Ligand TRAIL Receptor, Cytotoxic TRAIL Receptor, MGC9365, T10A, TNF Related Apoptosis Inducing Ligand Receptor 1, TRAIL Receptor 1, TRAIL R1, TRAILR1, TRAIL-R1, TRAILR-1, Tumor Necrosis Factor Receptor Superfamily Member 10a, TNFRSF10A) (MaxLight 550)

Size

£914.00

SKU:: 126013-ML550
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa105-204 from TNFRSF10A (AAH12866) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2E8
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
Extra Details:: MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000. Apoptosis is a normal process involving cell termination, homeostasis, development, and immunoreactivities. Several proteins involve in the process of the initiation of apoptosis, but two main methods of regulation have been identified: targeting mitochondria functionality, or directly transducing the signal via adapter proteins to the apoptotic mechanisms. The TNF-induced pathway and the Fas-Fas ligand-mediated pathway, both involving receptors of the TNF receptor (TNFR) family coupled to extrinsic signals, have been suggested in the direct signal transduction mechanism. In this model, the interaction of death factors such as FasL and TRAIL with the Fas and TNFR results in the formation of the death- inducing signaling complex (DISC), which contains the FADD, caspase-8 and caspase-10, initiating the process of programmed cell death. DR4 (death receptor 4 or TRAIL-R1) and DR5 (TRAIL-R2) are two signaling receptors of the TNF receptor (TNFR) gene superfamily that bind TRAIL. DR4/DR5 are transmembrane receptor proteins containing an intracellular death domain (DD). DRs Targeting has been widely used in cancer research and therapeutic potential. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PSSAATIKLHDQSIGTQQWEHSPLGELCPPGSHRSERPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPCTTTRNTACQCKPGTFRNDNSAEMC Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice