126013-HRP

DR4 (Death Receptor 4, Apo2, CD261, CD261 Antigen, Cytotoxic Ligand TRAIL Receptor, Cytotoxic TRAIL Receptor, MGC9365, T10A, TNF Related Apoptosis Inducing Ligand Receptor 1, TRAIL Receptor 1, TRAIL R1, TRAILR1, TRAIL-R1, TRAILR-1, Tumor Necrosis Factor Receptor Superfamily Member 10a, TNFRSF10A) (HRP)

Size

£914.00

SKU:: 126013-HRP
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa105-204 from TNFRSF10A (AAH12866) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2E8
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Extra Details:: Apoptosis is a normal process involving cell termination, homeostasis, development, and immunoreactivities. Several proteins involve in the process of the initiation of apoptosis, but two main methods of regulation have been identified: targeting mitochondria functionality, or directly transducing the signal via adapter proteins to the apoptotic mechanisms. The TNF-induced pathway and the Fas-Fas ligand-mediated pathway, both involving receptors of the TNF receptor (TNFR) family coupled to extrinsic signals, have been suggested in the direct signal transduction mechanism. In this model, the interaction of death factors such as FasL and TRAIL with the Fas and TNFR results in the formation of the death- inducing signaling complex (DISC), which contains the FADD, caspase-8 and caspase-10, initiating the process of programmed cell death. DR4 (death receptor 4 or TRAIL-R1) and DR5 (TRAIL-R2) are two signaling receptors of the TNF receptor (TNFR) gene superfamily that bind TRAIL. DR4/DR5 are transmembrane receptor proteins containing an intracellular death domain (DD). DRs Targeting has been widely used in cancer research and therapeutic potential. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PSSAATIKLHDQSIGTQQWEHSPLGELCPPGSHRSERPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPCTTTRNTACQCKPGTFRNDNSAEMC Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice