126007-BIOTIN
DPYSL2 (Dihydropyrimidinase-related Protein 2, DRP-2, Collapsin Response Mediator Protein 2, CRMP-2, N2A3, Unc-33-like Phosphoprotein 2, ULIP-2, CRMP2, ULIP2) (Biotin)
Size
£914.00
- SKU:
- 126007-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa470-571 from human DPYSL2 (NP_001377.1) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1F11
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- CRMP2 also regulates axon formation and branching by binding tubulin heterodimers thereby enhancing microtubule polymerisation. Through its interaction with ROKalpha, CRMP2 is also thought to play a role in RhoA-dependent signalling. CRMP2 is associated with mesial temporal lobe epilepsy and schizophrenia. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVAPPGGRANITSL Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice