DPH2 (Diphthamide Biosynthesis Protein 2, DPH2 Homolog, HsDph2, Diphthamide Biosynthesis Protein 2 Homolog-like 2, DPH2-like 2, DPH2L2)

Size

£685.00

SKU:: 125997
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa125-235 from human DPH2 (NP_001375) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5B10
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Required for the first step in the synthesis of diphthamide, a post-translational modification of histidine which occurs in translation elongation factor 2. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: RQRSVALELCVKAFEAQNPDPKAPVVLLSEPACAHALEALATLLRPRYLDLLVSSPAFPQPVGSLSPEPMPLERFGRRFPLAPGRRLEEYGAFYVGGSKASPDPDLDPDLS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.