DNTT (DNA Nucleotidylexotransferase, Terminal Addition Enzyme, Terminal Deoxynucleotidyltransferase, Terminal Transferase, TDT)

Size

£685.00

SKU:: 125978
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-110 from human DNTT (AAH12920) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4H5
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Terminal deoxynucleotidyl transferase (TdT) is a DNA polymerase that catalyses the polymerization of deoxynucleotides at the 3' hydroxyl ends of oligo or polydeoxynucleotide initiators and functions without a template. It is expressed in primitive T and B lympho- cytes of the thymus and bone marrow, and appears to have been highly activated in certain leukaemias. This antibody will help identify TdT in normal and uncharacterized tissues. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MDPPRASHLSPRKKRPRQTGALMASSPQDIKFQDLVVFILEKKMGTTRRAFLMELARRKGFRVENELSDSVTHIVAENNSGSDVLEWLQAQKVQVSSQPELLDVSWLIEC Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.