125932-PE

DNAJB2 (DnaJ Homolog Subfamily B Member 2, DnaJ Protein Homolog 1 Heat Shock 40kD Protein 3 Heat Shock Protein J1, HSJ-1, HSJ1, HSPF3) (PE)

Size

£914.00

SKU:: 125932-PE
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa216-324 from human DNAJB2 (NP_006727) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2C9
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Extra Details:: DnaJB2, also known as HSJ1 or HSPF3, is belongs to the DnaJ family. It is expressed almost exclusively in the brain, with the highest levels in the frontal cortex and hippocampus. The DnaJ family is one of the largest of all the chaperone families and has evolved with diverse cellular localization and functions. The DnaJ proteins play a critical role in the HSP70 chaperone machine by interacting with HSP70 to stimulate ATP hydrolysis. DnaJB2 is important mediators of proteolysis and are involved in the regulation of protein degradation, exocytosis and endocytosis. Applications: Suitable for use in Immunofluorescence, FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: LELSRREQQPSVTSRSGGTQVQQTPASCPLDSDLSEDEDLQLAMAYSLSEMEAAGKKPAGGREAQHRRQGRPKAQHQDPGLGGTQEGARGEATKRSPSPEEKASRCLIL Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice